{ "meta": { "disclaimer": "Do not rely on openFDA to make decisions regarding medical care. While we make every effort to ensure that data is accurate, you should assume all results are unvalidated. We may limit or otherwise restrict your access to the API in line with our Terms of Service.", "terms": "https://open.fda.gov/terms/", "license": "https://open.fda.gov/license/", "last_updated": "2025-09-19", "results": { "skip": 0, "limit": 1, "total": 1 } }, "results": [ { "codes": [ { "uuid": "fc4da9f6-2fab-4539-9da2-a9474e5fdc06", "code": "1312601", "comments": "RxNorm", "type": "PRIMARY", "url": "https://rxnav.nlm.nih.gov/REST/rxcui/1312601/allProperties.xml?prop=all", "code_system": "RXCUI", "references": [ "758cca70-4a44-47ec-9a0f-9caa1788d963" ] }, { "uuid": "79e00017-c1e6-a36d-44aa-454dfb2b2baf", "code": "ZR28QKN0WT", "type": "PRIMARY", "url": "https://dailymed.nlm.nih.gov/dailymed/search.cfm?adv=1&query=ZR28QKN0WT", "code_system": "DAILYMED", "references": [ "7e83f910-b5c6-cd61-4ba3-330b6c60dd09" ] }, { "uuid": "86eaf867-98a6-43d1-8f75-7d4f8b6b19ef", "code": "ZR28QKN0WT", "type": "PRIMARY", "code_system": "FDA UNII" } ], "substance_class": "protein", "names": [ { "uuid": "74fd7bd2-a66c-4777-a82b-ed4312f3d8c0", "name": "BIOTEIN E 10", "stdName": "BIOTEIN E 10", "type": "bn", "languages": [ "en" ], "preferred": false, "references": [ "b00d3f18-da3d-4bee-913d-e967f00c5e8b" ], "display_name": false }, { "uuid": "d9cc8a79-9337-4029-9ff6-a63e0c27711b", "name": "BIOTEIN E-10", "stdName": "BIOTEIN E-10", "type": "bn", "languages": [ "en" ], "preferred": false, "references": [ "b00d3f18-da3d-4bee-913d-e967f00c5e8b" ], "display_name": false }, { "uuid": "be64a330-c4a6-43a7-aa42-1b50b5d633ca", "name": "BIOTEIN E10 HYDROLYZED ELASTIN", "stdName": "BIOTEIN E10 HYDROLYZED ELASTIN", "type": "bn", "languages": [ "en" ], "preferred": false, "references": [ "b00d3f18-da3d-4bee-913d-e967f00c5e8b" ], "display_name": false }, { "uuid": "ca0dda72-ffe9-4efd-b6a7-301090fb0179", "name": "ELASTIN BOVINE, HYDROLYZED (1000 MW)", "stdName": "ELASTIN BOVINE, HYDROLYZED (1000 MW)", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "19f06232-5d50-4a24-bd8a-d9275fca2073" ], "display_name": false }, { "uuid": "1140eb02-1458-448b-8c44-f0304508afd7", "name": "HYDROLYZED BOVINE ELASTIN (BASE; 1000 MW)", "stdName": "HYDROLYZED BOVINE ELASTIN (BASE; 1000 MW)", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "19f06232-5d50-4a24-bd8a-d9275fca2073" ], "display_name": true }, { "uuid": "d49fd5e7-4338-43cd-b0e2-4032bae48a5a", "name": "HYDROLYZED ELASTIN", "stdName": "HYDROLYZED ELASTIN", "type": "of", "languages": [ "en" ], "preferred": true, "references": [ "34c26c80-2eac-4b54-9cf3-aa0a25ebfcb7", "b26649ac-fa95-4e40-915e-4750414fc9e8" ], "display_name": false, "domains": [ "cosmetic" ], "name_orgs": [ { "uuid": "07bf1ef7-d28a-465a-a8b7-71e39af7117a", "name_org": "INCI" } ] }, { "uuid": "a77a573a-d409-478b-abe0-bd00803a2ac5", "name": "HYDROLYZED ELASTIN BOVINE (ALKALINE HYDROLYZED; 1000 MW)", "stdName": "HYDROLYZED ELASTIN BOVINE (ALKALINE HYDROLYZED; 1000 MW)", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "b21fe2f9-26e8-42dc-8d55-b74de1751e27" ], "display_name": false }, { "uuid": "5b879b46-4bca-4701-8d20-708478712817", "name": "HYDROLYZED ELASTIN, BOVINE, ALKALINE (1000 MW)", "stdName": "HYDROLYZED ELASTIN, BOVINE, ALKALINE (1000 MW)", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "19f06232-5d50-4a24-bd8a-d9275fca2073" ], "display_name": false } ], "references": [ { "uuid": "b21fe2f9-26e8-42dc-8d55-b74de1751e27", "citation": "BIOTEIN E 10 ", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN", "PUBLIC_DOMAIN_RELEASE", "AUTO_SELECTED" ] }, { "uuid": "b00d3f18-da3d-4bee-913d-e967f00c5e8b", "citation": "http://www.bioorg.com/Biotein.html", "url": "http://www.bioorg.com/Biotein.html", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "19f06232-5d50-4a24-bd8a-d9275fca2073", "citation": "FDA_SRS", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "34c26c80-2eac-4b54-9cf3-aa0a25ebfcb7", "citation": "PCPC", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "758cca70-4a44-47ec-9a0f-9caa1788d963", "citation": "SRS CODE IMPORT", "doc_type": "SRS", "public_domain": true, "document_date": 1493391306000, "tags": [ "NOMEN" ] }, { "uuid": "5391f6a1-e947-433f-a681-51aa34492095", "citation": "SRS import [ZR28QKN0WT]", "url": "http://fdasis.nlm.nih.gov/srs/srsdirect.jsp?regno=ZR28QKN0WT", "doc_type": "SRS", "public_domain": true, "document_date": 1493391306000, "tags": [ "NOMEN" ] }, { "uuid": "be88308a-a3dc-4e62-bba9-d0e5ec2db910", "citation": "e-10 info sheet", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "b26649ac-fa95-4e40-915e-4750414fc9e8", "citation": "HYDROLYZED ELASTIN [INCI]", "doc_type": "SRS_LOCATOR", "public_domain": true }, { "uuid": "7e83f910-b5c6-cd61-4ba3-330b6c60dd09", "citation": "DailyMed", "doc_type": "DAILYMED", "public_domain": true } ], "definition_type": "PRIMARY", "protein": { "uuid": "452b0472-3025-421c-882a-119bfdf32438", "glycosylation": { "uuid": "cd6753d2-038f-4979-8d01-72fd0e898180", "glycosylation_type": "MAMMALIAN", "n_glycosylation_sites": [ { "residue_index": 299, "subunit_index": 1 } ] }, "subunits": [ { "uuid": "741a156c-51c6-47ba-a63a-003b987fa73e", "sequence": "GGVPGAVPGGVPGGVFFPGAGLGGLGVGGLGPGVKPAKPGVGGLVGPGLGAEGSALPGAFPGGFFGAGGGAAGAAAAYKAAAKAGAAGLGVGGIGGVGGLGVSTGAVVPQLGAGVGAGVKPGKVPGVGLPGVYPGGVLPGAGARFPGIGVLPGVPTGAGVKPKAQVGAGAFAGIPGVGPFGGQQPGLPLGYPIKAPKLPAGYGLPYKTGKLPYGFGPGGVAGSAGKAGYPTGTGVGPQAAAAAAKAAAKLGAGGAGVLPGVGVGGPGIPGAPGAIPGIGGIAGVGAPDAAAAAAAAAKAAKFGAAGGLPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGALSPAATAKAAAKAAKFGARGAVGIGGIPTFGLGPGGFPGIGDAAAAPAAAAAKAAKIGAGGVGALGGVVPGAPGAIPGLPGVGGVPGVGIPAAAAAKAAAKAAQFGLGPGVGVAPGVGVVPGVGVVPGVGVAPGIGLGPGGVIGAGVPAAAKSAAKAAAKAQFRAAAGLPAGVPGLGVGAGVPGLGVGAGVPGLGVGAGVPGPGAVPGTLAAAKAAKFGPGGVGALGGVGDLGGAGIPGGVAGVVPAAAAAAKAAAKAAQFGLGGVGGLGVGGLGAVPGAVGLGGVSPAAAAKAAKFGAAGLGGVLGAGQPFPIGGGAGGLGVGGKPPKPFGGALGALGFPGGACLGKSCGRKRK", "subunit_index": 1 } ], "references": [ "5391f6a1-e947-433f-a681-51aa34492095", "be88308a-a3dc-4e62-bba9-d0e5ec2db910" ], "disulfide_links": [ { "sites": [ { "residue_index": 711, "subunit_index": 1 }, { "residue_index": 716, "subunit_index": 1 } ] } ], "protein_sub_type": "", "sequence_type": "COMPLETE" }, "definition_level": "COMPLETE", "uuid": "80085daf-1f39-47e7-9efb-1b982c0a1e65", "version": "7", "properties": [ { "uuid": "1d2e9189-497d-42cf-8db4-a3114a89b0aa", "name": "MOL_WEIGHT", "type": "amount", "value": { "uuid": "108d1b68-d85b-44a1-89d7-7d1112c62f55", "average": 1000, "units": "Da" }, "defining": false, "property_type": "CHEMICAL" }, { "uuid": "90b030c7-5421-4968-a90f-8159bc947de9", "name": "Molecular Formula", "value": { "uuid": "3aaacdcc-bbf7-4587-92eb-9577a529a6aa", "type": "ESTIMATED", "non_numeric_value": "C2798H4507N783O761S2" }, "defining": false, "property_type": "CHEMICAL" } ], "modifications": { "uuid": "a0c6c2d8-fded-4b85-88d7-57b563537db7", "structural_modifications": [ { "uuid": "537c4307-2e1a-4c69-8a8b-05ed37035215", "extent": "COMPLETE", "sites": [ { "residue_index": 8, "subunit_index": 1 }, { "residue_index": 39, "subunit_index": 1 }, { "residue_index": 61, "subunit_index": 1 }, { "residue_index": 139, "subunit_index": 1 }, { "residue_index": 152, "subunit_index": 1 }, { "residue_index": 155, "subunit_index": 1 }, { "residue_index": 162, "subunit_index": 1 }, { "residue_index": 175, "subunit_index": 1 }, { "residue_index": 272, "subunit_index": 1 }, { "residue_index": 276, "subunit_index": 1 }, { "residue_index": 309, "subunit_index": 1 }, { "residue_index": 339, "subunit_index": 1 }, { "residue_index": 344, "subunit_index": 1 }, { "residue_index": 354, "subunit_index": 1 }, { "residue_index": 359, "subunit_index": 1 }, { "residue_index": 436, "subunit_index": 1 }, { "residue_index": 452, "subunit_index": 1 }, { "residue_index": 540, "subunit_index": 1 }, { "residue_index": 549, "subunit_index": 1 }, { "residue_index": 558, "subunit_index": 1 }, { "residue_index": 567, "subunit_index": 1 }, { "residue_index": 573, "subunit_index": 1 }, { "residue_index": 604, "subunit_index": 1 }, { "residue_index": 693, "subunit_index": 1 }, { "residue_index": 707, "subunit_index": 1 } ], "molecular_fragment": { "uuid": "e2c7ee6a-3601-4684-85e6-0c67f4e72066", "refuuid": "3c384bf3-d8b4-4af5-a982-0914ecd49130", "name": "HYDROXYPROLINE", "unii": "RMB44WO89X", "linking_id": "RMB44WO89X", "ref_pname": "HYDROXYPROLINE", "substance_class": "reference" }, "residue_modified": "PROLINE", "structural_modification_type": "FRAGMENT" }, { "uuid": "256fc732-0b98-40dc-944f-4a5da0c97e85", "extent": "COMPLETE", "sites": [ { "residue_index": 79, "subunit_index": 1 }, { "residue_index": 83, "subunit_index": 1 }, { "residue_index": 226, "subunit_index": 1 }, { "residue_index": 245, "subunit_index": 1 }, { "residue_index": 249, "subunit_index": 1 }, { "residue_index": 298, "subunit_index": 1 }, { "residue_index": 301, "subunit_index": 1 }, { "residue_index": 518, "subunit_index": 1 }, { "residue_index": 522, "subunit_index": 1 }, { "residue_index": 526, "subunit_index": 1 }, { "residue_index": 619, "subunit_index": 1 }, { "residue_index": 623, "subunit_index": 1 }, { "residue_index": 659, "subunit_index": 1 }, { "residue_index": 662, "subunit_index": 1 } ], "molecular_fragment": { "uuid": "80c57d23-06b7-405d-98d0-089f949fd794", "refuuid": "672d2e30-c4fb-4d65-ad63-75242cf6643d", "name": "ALLYSINE", "unii": "425I4Y24YZ", "linking_id": "425I4Y24YZ", "ref_pname": "ALLYSINE", "substance_class": "reference" }, "residue_modified": "LYSINE", "structural_modification_type": "FRAGMENT" } ] }, "unii": "ZR28QKN0WT" } ] }