{ "meta": { "disclaimer": "Do not rely on openFDA to make decisions regarding medical care. While we make every effort to ensure that data is accurate, you should assume all results are unvalidated. We may limit or otherwise restrict your access to the API in line with our Terms of Service.", "terms": "https://open.fda.gov/terms/", "license": "https://open.fda.gov/license/", "last_updated": "2026-09-09", "results": { "skip": 0, "limit": 1, "total": 1 } }, "results": [ { "codes": [ { "uuid": "b5b91a59-e2f8-4b3a-88d7-2d741cb49cc6", "code": "SUB32840", "type": "PRIMARY", "code_system": "EVMPD", "references": [ "738146b7-5451-49d2-a887-77c9c60fab21" ] }, { "uuid": "b7c5135c-1cd5-4e80-b89d-55ea871a548f", "code": "D017228", "type": "PRIMARY", "url": "http://www.ncbi.nlm.nih.gov/mesh/68017228", "code_system": "MESH", "references": [ "738146b7-5451-49d2-a887-77c9c60fab21" ] }, { "uuid": "417408b0-160c-2a5d-4772-0b3f480108b2", "code": "C530", "comments": "Pharmacologic Substance[C1909]|Biological Agent[C307]|Recombinant Growth Factor", "type": "CONCEPT", "url": "https://ncit.nci.nih.gov/ncitbrowser/ConceptReport.jsp?dictionary=NCI%20Thesaurus&code=C530", "code_system": "NCI_THESAURUS", "references": [ "65db5b2b-c034-3e15-527d-3d8fd8f181b0" ] }, { "uuid": "a07bcc3c-abc1-6ef4-6b2d-4928b3b8642b", "code": "C1122", "comments": "NCIT", "type": "PRIMARY", "url": "https://ncit.nci.nih.gov/ncitbrowser/ConceptReport.jsp?dictionary=NCI%20Thesaurus&code=C1122", "code_system": "NCI_THESAURUS", "references": [ "4d7bf05a-7aad-7a82-246b-a74a3f94894b" ] }, { "uuid": "30cd5db8-d99d-4f9c-9018-740c05ca2f1d", "code": "2TEN8A78E7", "type": "PRIMARY", "code_system": "FDA UNII" } ], "substance_class": "protein", "names": [ { "uuid": "9088913d-5dfe-6ad1-3927-9e28c86e7820", "name": "HEPATOPOIETIN-A", "stdName": "HEPATOPOIETIN-A", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "97a43e52-1bf0-0601-d8e1-efb02bfa33a6" ], "display_name": true }, { "uuid": "b919fa39-151d-cc15-0858-93275def310f", "name": "Hepatocyte growth factor [WHO-DD]", "stdName": "HEPATOCYTE GROWTH FACTOR [WHO-DD]", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "53458c70-4c12-f6cd-dd11-c27f70fc463f" ], "display_name": false }, { "uuid": "39323f70-25bf-9c7e-5009-864dd5127eb7", "name": "RECOMBINANT HUMAN HEPATOCYTE GROWTH FACTOR", "stdName": "RECOMBINANT HUMAN HEPATOCYTE GROWTH FACTOR", "type": "cn", "languages": [ "en" ], "preferred": false, "references": [ "5a643501-5f08-4534-b516-31fd8cc97043" ], "display_name": false } ], "references": [ { "uuid": "06a1cea9-a2ac-49fd-8ced-45633d156f4d", "citation": "HEPATOCYTE GROWTH FACTOR [WHO-DD]", "doc_type": "SRS_LOCATOR", "public_domain": true }, { "uuid": "5a643501-5f08-4534-b516-31fd8cc97043", "citation": "SRS", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "66e10b6f-4a21-4b29-b4f3-145ae356eb7e", "citation": "SRS import [[ingredient] 0262657AA]", "url": "http://fdasis.nlm.nih.gov/srs/srsdirect.jsp?regno=[ingredient] 0262657AA", "doc_type": "SRS", "public_domain": true, "document_date": 1493394628000, "tags": [ "NOMEN" ] }, { "uuid": "738146b7-5451-49d2-a887-77c9c60fab21", "citation": "SRS CODE IMPORT", "doc_type": "SRS", "public_domain": true, "document_date": 1493394628000, "tags": [ "NOMEN" ] }, { "uuid": "ac30b05d-faf5-49eb-b49c-fc2c6e6ebb10", "citation": "WHO DRUG DICTIONARY", "doc_type": "WHO DRUG DICTIONARY", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "d45b76d4-d79a-4266-a9db-c86ee831833b", "citation": "WHO-DD", "doc_type": "SRS", "public_domain": true, "tags": [ "NOMEN" ] }, { "uuid": "97a43e52-1bf0-0601-d8e1-efb02bfa33a6", "citation": "http://www.uniprot.org/uniprot/P14210", "doc_type": "UNIPROT", "public_domain": true, "tags": [ "PUBLIC_DOMAIN_RELEASE" ] }, { "uuid": "65db5b2b-c034-3e15-527d-3d8fd8f181b0", "doc_type": "SYSTEM", "public_domain": true }, { "uuid": "4d7bf05a-7aad-7a82-246b-a74a3f94894b", "citation": "NCIT", "doc_type": "NCI THESAURUS", "public_domain": true }, { "uuid": "53458c70-4c12-f6cd-dd11-c27f70fc463f", "citation": "WHO-DD", "doc_type": "WHO DRUG DICTIONARY", "public_domain": true } ], "definition_type": "PRIMARY", "protein": { "uuid": "bc8f416c-109e-4010-af52-79db244e63d9", "glycosylation": { "uuid": "016ba882-a5b1-485e-b3ba-d627e9c9e328", "glycosylation_type": "MAMMALIAN", "n_glycosylation_sites": [ { "residue_index": 263, "subunit_index": 1 }, { "residue_index": 371, "subunit_index": 1 }, { "residue_index": 72, "subunit_index": 2 }, { "residue_index": 159, "subunit_index": 2 } ], "o_glycosylation_sites": [ { "residue_index": 445, "subunit_index": 1 } ] }, "subunits": [ { "uuid": "51e02b0a-e2e7-4758-a234-a4ab9a147007", "sequence": "QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR", "subunit_index": 1 }, { "uuid": "eceabbf3-878d-4a2f-8e6a-217ead3cbebd", "sequence": "VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "subunit_index": 2 } ], "references": [ "97a43e52-1bf0-0601-d8e1-efb02bfa33a6", "d45b76d4-d79a-4266-a9db-c86ee831833b" ], "disulfide_links": [ { "sites": [ { "residue_index": 39, "subunit_index": 1 }, { "residue_index": 65, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 43, "subunit_index": 1 }, { "residue_index": 53, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 97, "subunit_index": 1 }, { "residue_index": 175, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 118, "subunit_index": 1 }, { "residue_index": 158, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 146, "subunit_index": 1 }, { "residue_index": 170, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 180, "subunit_index": 1 }, { "residue_index": 257, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 201, "subunit_index": 1 }, { "residue_index": 240, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 229, "subunit_index": 1 }, { "residue_index": 252, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 274, "subunit_index": 1 }, { "residue_index": 352, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 295, "subunit_index": 1 }, { "residue_index": 334, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 323, "subunit_index": 1 }, { "residue_index": 346, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 360, "subunit_index": 1 }, { "residue_index": 438, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 381, "subunit_index": 1 }, { "residue_index": 421, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 409, "subunit_index": 1 }, { "residue_index": 433, "subunit_index": 1 } ] }, { "sites": [ { "residue_index": 456, "subunit_index": 1 }, { "residue_index": 110, "subunit_index": 2 } ] }, { "sites": [ { "residue_index": 25, "subunit_index": 2 }, { "residue_index": 41, "subunit_index": 2 } ] }, { "sites": [ { "residue_index": 67, "subunit_index": 2 }, { "residue_index": 185, "subunit_index": 2 } ] }, { "sites": [ { "residue_index": 148, "subunit_index": 2 }, { "residue_index": 164, "subunit_index": 2 } ] }, { "sites": [ { "residue_index": 175, "subunit_index": 2 }, { "residue_index": 203, "subunit_index": 2 } ] } ], "protein_sub_type": "", "protein_type": "GROWTH FACTOR", "sequence_origin": "HUMAN", "sequence_type": "COMPLETE" }, "definition_level": "COMPLETE", "uuid": "4549aba3-548a-4325-a18e-33d539754734", "version": "13", "properties": [ { "uuid": "a0c73957-60e0-45f6-9be9-ae4953f79948", "name": "MOL_WEIGHT:NUMBER(CALCULATED)", "type": "amount", "value": { "uuid": "ad9045d6-a76f-479c-b65f-3903f7eae77c", "type": "ESTIMATED", "average": 79700, "units": "Da" }, "defining": false, "property_type": "CHEMICAL" }, { "uuid": "f39490af-9015-4cee-8c26-bf90114e230e", "name": "Molecular Formula", "value": { "uuid": "f7a2f309-4348-44f4-9b53-2fa152a98561", "type": "ESTIMATED", "non_numeric_value": "C3486H5357O1036N1000S56" }, "defining": false, "property_type": "CHEMICAL" } ], "modifications": { "uuid": "86541e7b-cf90-47b3-9f6a-fe55ed2fe301", "structural_modifications": [ { "uuid": "7f5e6fbd-d159-4ad3-8828-929e8ff7acac", "extent": "COMPLETE", "sites": [ { "residue_index": 1, "subunit_index": 1 } ], "location_type": "N-TERMINUS", "molecular_fragment": { "uuid": "ef4ceecb-7cfc-4dd9-9e1d-ad45eca68f78", "refuuid": "b4015ea9-cdb5-43db-87a3-91407212b35b", "name": "PIDOLIC ACID", "unii": "SZB83O1W42", "linking_id": "SZB83O1W42", "ref_pname": "PIDOLIC ACID", "substance_class": "reference" }, "structural_modification_type": "AMINO_ACID_SUBSTITUTION" } ] }, "unii": "2TEN8A78E7" } ] }